Wellnessmarketer.com

WellnessMarketer offers a great selection of magnetic and wellness jewelry

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Wellnessmarketer.com Domain Statistics

Title:
WellnessMarketer Magnetic and Wellness Jewelry
Description:
WellnessMarketer offers a great selection of magnetic and wellness jewelry
SEO score:
25%
Website Worth:
$4,001 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Primary Traffic:
The country where current domain is most popular relative to the other countries
united states
Webstatsdomain backlinks:
IP-address:
104.195.72.226 [Trace] [Reverse]
Pageviews per User:
4
Average Time on Site:
03:50
Search Percent:
Estimated percentage of visits to www.wellnessmarketer.com that came from a search engine
50%
Bounce:
Estimated percentage of visits to www.wellnessmarketer.com that consist of a single pageview
35%
Daily Pageviews:
n\a
Load Time:
0.25 seconds
advertising

Wellnessmarketer.com competitors

 

Hottime Jewelry Co., Ltd. - Bracelet,magnetic Bracelet

Hottime jewelry co., ltd., experts in manufacturing and exporting bracelet, magnetic bracelet and 35404 more products

| | hottime.cn

 

Dinor Jewelry - Wholesale Stainless Steel Jewelry From China – Ssdinor...

Stainless steel jewelry wholesale, fashion jewelry wholesale, bracelets, rings, earrings, necklaces

| | www.ssdinor.com

 

Magnetic Necklace Leather Bracelets Wedding Rhinestone Jewelry

Magnetic necklace magnetic jewelry necklace bracelet fashion jewelry gold silver rhodium necklace

| | newdawnjewelry.com

 

Magnetic Jewelry & Magnet Therapy Products

Best quality magnetic jewelry and magnet therapy products - over 1300 items that are good for healthas

| | www.everythingmagnet.com

 

Magnetic Jewelry Home-zappydots

Zappy dots - interchangeable magnetic jewelry & pendants

| | zappydots.com

 

Ulyta Jewelry Wholesale : Stainless Steel Jewelry Wholesale, Necklaces...

Ulyta manufacture and wholesale : stainless steel necklaces, earrings, rings, bracelets, pendants, pendant

| | www.ulyta.com

 

Magnetic Bracelets - Magnetic Necklaces, Copper Bracelets...

Magnetic bracelets, magnetic necklaces, copper bracelets, tifosi sunglasses, and sterling silver

| | www.billythetree.com

 

Nicole Hanna Jewelry - Nicole Hanna Jewelry

Wire wrap jewelry and wearable art, with an emphasize on one of a kind creative focals

| | www.nicolehannajewelry.com

 

Sstinor.com Jewelry Wholesale Company Limited...

Sstinor.com manufacture and wholesale : stainless steel necklaces, earrings, rings, bracelets, pendants

| | sstinor.com

 

Steel Jewelry Factory, Steel Watch Factory | Donny j Hong Kong Ltd

Stainless steel jewelry factory, steel watch factory specialized in custom manufacturing since 1997with reliable customer

| | www.djhk.biz

Wellnessmarketer.com Sites with a similar domain name

We found 16 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Уеб Достъпът До Този Сайт е Временно Ограничен

5 важни стъпки те делят от успеха: преоткрий себе си,... Обучавай се,... Действай,... Стани лидер,... Бъди финансово независим!... Може да го направим заедно!

| | wellnessmarketing-bg.com

 

Welcome to Wellnessmarketplace.com

| | wellnessmarketplace.com

 

Wellness Marketing Group |

| | wellnessmarketinggroup.com

 

Wellness Marketing Machines

| | wellnessmarketingmachines.com

 

Salon Spa American Canyon

Salon & spa located in american canyon. We offer green hair salon, facials, massages, manicures and pedicures

| | wellnessmarketplacenapavalley.com

 

Wellnessmarket.biz

| | wellnessmarket.biz

 

Wellnessmarket.net

| | wellnessmarket.net

 

Linelogix® - Session Expired!

| | wellnessmarketcenter.com

 

Wellnessmarketing.biz

Wellnessmarketing.biz

| | wellnessmarketing.biz

 

Wellnessmarketingdotcom.com

Find cash advance, debt consolidation and more at wellnessmarketingdotcom.com. Get the best of insurance or free credit report, browse our section on cell phones or learn about life insurance. Wellnessmarketingdotcom.com is the site for cash advance

| | wellnessmarketingdotcom.com

 

Wellnessmarketingforchiropractors.com

| | wellnessmarketingforchiropractors.com

 

Wellnessmarketingforum.com

| | wellnessmarketingforum.com

 

Wellnessmarketingforum.net

| | wellnessmarketingforum.net

Wellnessmarketer.com Contact information :

http://wellnessmarketer.com/aboutus.aspx - About WellnessMarketer
http://wellnessmarketer.com/contact-us.aspx - WellnessMarketer Magnetic and Wellness Jewelry - Contact Us
See wellnessmarketer.com contact information in whois record

Web Safety

wellnessmarketer.com is not safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing: n\a
Avg Antivirus n\a
Wot Raiting n\a
SiteAdvisor n\a
Child Safety n\a

Wellnessmarketer.com Visitors Localization

Traffic Estimations Low
Traffic Rank 954,138th most visited website in the World
united states 70.5

Website categories

Currently, we found 9 categories on wellnessmarketer.com
magnetic jewelry 223 sites magnetic bracelets 198 sites
wellness 88'723 sites qray 13 sites
sabona 44 sites bracelet 17'814 sites
Show more

Wellnessmarketer.com Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
wellness marketer
1 2016-02-13
magnetic bracelets for men
1 2016-02-03
magnetic braclets
1 2015-11-26
bracelet magnetique
2 2016-02-13
q ray
2 2016-01-23
q-ray
2 2016-01-01
magnetic bracelts for men
2 2015-12-20
negative ions bracelet trion
3 2016-02-10
magnetic anklet
3 2015-12-09
q ray bracelet
4 2016-01-23

Wellnessmarketer.com Websites hosted on same IP

 

no Contract Refurbished Phones Straight Talk, Total Wireless...

Refurbished phones for straight talk, total wireless, pageplus and verizon prepaid. No contract prepaid phones with 4g. Free shipping. Money-back guarantee

| | www.iconvertwireless.com

Wellnessmarketer.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.25. The highest load time is 0.88, the lowest load time is 0.25, the average load time is 0.43.

Whois Lookup For wellnessmarketer.com

0reviews

Add review